-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ESRRB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 434-508 of human ESRRB (NP_004443.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ESRRB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 434-508 of human ESRRB (NP_004443.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09027A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ESRRB |
| Target Synonyms | ERR2; ERRb; ESRL2; NR3B2; DFNB35; ERRbeta2; ERR beta-2; ESRRB | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293F, HT-29, K-562 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 434-508 of human ESRRB (NP_004443.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GQEQLRGSPKDERMSSHDGKCPFQSAAFTSRDQSNSPGIPNPRPSSPTPLNERGRQISPSTRTPGGQGKHLWLTM | Uniprot ID | O95718 |
Uniprot Id
O95718
Target Species
Human
Target Name
ESRRB
Target Full Name
Steroid hormone receptor ERR2
Target Function
Transcription factor that binds a canonical ESRRB recognition (ERRE) sequence 5'TCAAGGTCA-3' localized on promoter and enhancer of targets genes regulating their expression or their transcription activity. Plays a role, in a LIF-independent manner, in maintainance of self-renewal and pluripotency of embryonic and trophoblast stem cells through different signaling pathways including FGF signaling pathway and Wnt signaling pathways. Upon FGF signaling pathway activation, interacts with KDM1A by directly binding to enhancer site of ELF5 and EOMES and activating their transcription leading to self-renewal of trophoblast stem cells. Also regulates expression of multiple rod-specific genes and is required for survival of this cell type. Plays a role as transcription factor activator of GATA6, NR0B1, POU5F1 and PERM1. Plays a role as transcription factor repressor of NFE2L2 transcriptional activity and ESR1 transcriptional activity. During mitosis remains bound to a subset of interphase target genes, including pluripotency regulators, through the canonical ESRRB recognition (ERRE) sequence, leading to their transcriptional activation in early G1 phase. Can coassemble on structured DNA elements with other transcription factors like SOX2, POU5F1, KDM1A and NCOA3 to trigger ESRRB-dependent gene activation. This mechanism, in the case of SOX2 corecruitment prevents the embryonic stem cells (ESCs) to epiblast stem cells (EpiSC) transition through positive regulation of NR0B1 that inhibits the EpiSC transcriptional program. Also plays a role inner ear development by controlling expression of ion channels and transporters and in early placentation.; Transcription factor that binds a canonical ESRRB recognition (ERRE) sequence 5'TCAAGGTCA-3' localized on promoter and enhancer of targets genes regulating their expression or their transcription activity. Positively regulates ESR1 transcriptional activity upon E2 stimulation.
Target Involvement
Deafness, autosomal recessive, 35 (DFNB35)
Target Subcellular Location
Nucleus. Cytoplasm. Chromosome.
Target Protein Families
Nuclear hormone receptor family, NR3 subfamily
Target Synonyms
Err 2; ERR b; ERR B2; ERR beta 2; ERR beta; ERR beta-2; ERR-beta; Err2; ERR2_HUMAN; ERRB 2; ERRb; ERRB2; ERRbeta 2; ERRbeta; ESR L2; ESRL 2; ESRL2; Esrrb; Estrogen receptor like 2; Estrogen receptor related 2; Estrogen receptor-like 2; Estrogen-related receptor beta; Estrrb; Nr3b2; Nuclear receptor ERRB2; Nuclear receptor subfamily 3 group B member 2; Orphan nuclear receptor; Steroid hormone receptor ERR 2; Steroid hormone receptor ERR2
Target Background
This gene encodes a protein with similarity to the estrogen receptor. Its function is unknown; however, a similar protein in mouse plays an essential role in placental development.
Notification