-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ESRRG was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human ESRRG (NP_001429.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ESRRG was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human ESRRG (NP_001429.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04050A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ESRRG |
| Target Synonyms | ERR3; ERRg; NR3B3; ERRgamma; ERR-gamma; ESRRG | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human ESRRG (NP_001429.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIY | Uniprot ID | P62508 |
Uniprot Id
P62508
Target Species
Human
Target Name
ESRRG
Target Full Name
Estrogen-related receptor gamma
Target Function
Orphan receptor that acts as transcription activator in the absence of bound ligand. Binds specifically to an estrogen response element and activates reporter genes controlled by estrogen response elements. Induces the expression of PERM1 in the skeletal muscle.
Target Subcellular Location
Nucleus.
Target Protein Families
Nuclear hormone receptor family, NR3 subfamily
Target Tissue Specificity
Expressed in the heart, kidney, brain, lung, bone marrow, adrenal gland, trachea, spinal cord and thyroid gland.
Target Synonyms
DKFZp781L1617; ERR 3; ERR G2; ERR gamma 2 ; ERR gamma-2; ERR3; ERR3_HUMAN; ERRG 2; ERRG2 ; ERRgamma; ESRRG; Estrogen receptor related protein 3; Estrogen receptor-related protein 3; Estrogen-related receptor gamma; FLJ16023; KIAA0832; NR3B3; Nuclear receptor subfamily 3 group B member 3
Target Background
This gene encodes a member of the estrogen receptor-related receptor (ESRR) family, which belongs to the nuclear hormone receptor superfamily. All members of the ESRR family share an almost identical DNA binding domain, which is composed of two C4-type zinc finger motifs. The ESRR members are orphan nuclear receptors; they bind to the estrogen response element and steroidogenic factor 1 response element, and activate genes controlled by both response elements in the absence of any ligands. The ESRR family is closely related to the estrogen receptor (ER) family. They share target genes, co-regulators and promoters, and by targeting the same set of genes, the ESRRs seem to interfere with the ER-mediated estrogen response in various ways. It has been reported that the family member encoded by this gene functions as a transcriptional activator of DNA cytosine-5-methyltransferases 1 (Dnmt1) expression by direct binding to its response elements in the DNMT1 promoters, modulates cell proliferation and estrogen signaling in breast cancer, and negatively regulates bone morphogenetic protein 2-induced osteoblast differentiation and bone formation. Multiple alternatively spliced transcript variants have been identified, which mainly differ at the 5' end and some of which encode protein isoforms differing in the N-terminal region.
Notification