Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ESYT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 90-220 of human ESYT1 (NP_056107.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ESYT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 90-220 of human ESYT1 (NP_056107.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05079A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ESYT1 |
| Target Synonyms | MBC2; FAM62A; ESYT1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, 293T, Jurkat, LO2, Mouse brain, U-251MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 90-220 of human ESYT1 (NP_056107.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GWRRVRDEKERSLRAARQLLDDEEQLTAKTLYMSHRELPAWVSFPDVEKAEWLNKIVAQVWPFLGQYMEKLLAETVAPAVRGSNPHLQTFTFTRVELGEKPLRIIGVKVHPGQRKEQILLDLNISYVGDVQ | Uniprot ID | Q9BSJ8 |
Uniprot Id
Q9BSJ8
Target Species
Human
Target Name
ESYT1
Target Full Name
Extended synaptotagmin-1
Target Function
Binds glycerophospholipids in a barrel-like domain and may play a role in cellular lipid transport. Binds calcium (via the C2 domains) and translocates to sites of contact between the endoplasmic reticulum and the cell membrane in response to increased cytosolic calcium levels. Helps tether the endoplasmic reticulum to the cell membrane and promotes the formation of appositions between the endoplasmic reticulum and the cell membrane.
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell membrane; Peripheral membrane protein.
Target Protein Families
Extended synaptotagmin family
Target Tissue Specificity
Widely expressed.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
E Syt1; E-Syt1; Esyt1; ESYT1_HUMAN; Extended synaptotagmin 1; Extended synaptotagmin like protein 1; Extended synaptotagmin-1; FAM62A; Family with sequence similarity 62 (C2 domain containing) member A; Family with sequence similarity 62 member A; KIAA0747; MBC2; Membrane bound C2 domain containing protein; Membrane-bound C2 domain-containing protein; Protein FAM62A
Target Background
Enables identical protein binding activity. Predicted to be involved in endoplasmic reticulum-plasma membrane tethering and lipid transport. Located in endoplasmic reticulum. Is integral component of endoplasmic reticulum membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
