Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ETF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 278-437 of human ETF1 (NP_004721.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ETF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 278-437 of human ETF1 (NP_004721.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-03624A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ETF1 |
| Target Synonyms | ERF; RF1; ERF1; TB3-1; D5S1995; SUP45L1; ETF1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Rat heart, HT-1080, Mouse liver, Raji, SKOV3, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 278-437 of human ETF1 (NP_004721.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VKFIQEKKLIGRYFDEISQDTGKYCFGVEDTLKALEMGAVEILIVYENLDIMRYVLHCQGTEEEKILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEFFDLDDY | Uniprot ID | P62495 |
Uniprot Id
P62495
Target Species
Human
Target Name
ETF1
Target Full Name
Eukaryotic peptide chain release factor subunit 1
Target Function
Directs the termination of nascent peptide synthesis (translation) in response to the termination codons UAA, UAG and UGA. Component of the transient SURF complex which recruits UPF1 to stalled ribosomes in the context of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Required for SHFL-mediated translation termination which inhibits programmed ribosomal frameshifting (-1PRF) of mRNA from viruses and cellular genes.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Eukaryotic release factor 1 family
Target Synonyms
Cl1 protein; D5S1995; ERF; eRF1; ERF1_HUMAN; ETF1; Eukaryotic peptide chain release factor subunit 1; Eukaryotic release factor 1; Eukaryotic translation termination factor 1; MGC111066; Polypeptide chain release factor 1; Protein Cl1; RF1; Sup45 (yeast omnipotent suppressor 45) homolog like 1; SUP45L1; TB3 1; TB3-1
Target Background
This gene encodes a class-1 polypeptide chain release factor. The encoded protein plays an essential role in directing termination of mRNA translation from the termination codons UAA, UAG and UGA. This protein is a component of the SURF complex which promotes degradation of prematurely terminated mRNAs via the mechanism of nonsense-mediated mRNA decay (NMD). Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 6, 7, and X.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
