Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ETV4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 79-178 of human ETV4 (NP_001977.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ETV4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 79-178 of human ETV4 (NP_001977.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05983A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ETV4 |
| Target Synonyms | E1AF; PEA3; E1A-F; PEAS3; ETV4 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 79-178 of human ETV4 (NP_001977.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PDFHSENLAFHSPTTRIKKEPQSPRTDPALSCSRKPPLPYHHGEQCLYSSAYDPPRQIAIKSPAPGALGQSPLQPFPRAEQRNFLRSSGTSQPHPGHGYL | Uniprot ID | P43268 |
Uniprot Id
P43268
Target Species
Human
Target Name
ETV4
Target Full Name
ETS translocation variant 4
Target Function
Transcriptional activator. May play a role in keratinocyte differentiation.; (Microbial infection) Binds to the enhancer of the adenovirus E1A gene and acts as a transcriptional activator; the core-binding sequence is 5'-[AC]GGA[AT]GT-3'.
Target Subcellular Location
Nucleus.
Target Protein Families
ETS family
Target Tissue Specificity
Expressed in keratinocytes.
Target Synonyms
Adenovirus E1A enhancer binding protein; Adenovirus E1A enhancer-binding protein; E1A F; E1A-F; ETS translocation variant 4; ets variant gene 4 (E1A enhancer binding protein E1AF); ETV4; ETV4_HUMAN; PEA3; PEA3 protein; PEAS3; Polyomavirus enhancer activator 3; Polyomavirus enhancer activator 3 homolog; Protein PEA3
Target Background
Enables DNA-binding transcription activator activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in positive regulation of keratinocyte differentiation and positive regulation of transcription by RNA polymerase II. Located in chromosome and nucleolus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
