Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EVA1A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 90-152 of human EVA1A (NP_115557.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against EVA1A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 90-152 of human EVA1A (NP_115557.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-10952A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EVA1A |
| Target Synonyms | FAM176A; TMEM166; EVA1A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 90-152 of human EVA1A (NP_115557.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DTVSDLSVRRHRRFERTLNKNVFTSAEELERAQRLEERERIIREIWMNGQPEVPGTRSLNRYY | Uniprot ID | Q9H8M9 |
Uniprot Id
Q9H8M9
Target Species
Human
Target Name
EVA1A
Target Full Name
Protein eva-1 homolog A
Target Function
Acts as a regulator of programmed cell death, mediating both autophagy and apoptosis.
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Lysosome membrane; Single-pass membrane protein.
Target Protein Families
EVA1 family
Target Tissue Specificity
Expressed in lung, kidney, liver, pancreas, placenta, but not in heart and skeletal muscle.
Target Synonyms
EVA1A; FAM176A; TMEM166; SP24; Protein eva-1 homolog A; Protein FAM176A; Transmembrane protein 166
Target Background
Predicted to be involved in apoptotic process and autophagy. Located in intracellular membrane-bounded organelle and plasma membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
