-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EYA2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human EYA2 (NP_005235.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EYA2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human EYA2 (NP_005235.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05293A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EYA2 |
| Target Synonyms | EAB1; EYA2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-549 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human EYA2 (NP_005235.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TSVRIGLMMEEMIFNLADTHLFFNDLEDCDQIHVDDVSSDDNGQDLSTYNFSADGFHSSAPGANLCLGSGVHGGVDWMRKLAFRYRRVKEMYNTYKNNVGG | Uniprot ID | O00167 |
Uniprot Id
O00167
Target Species
Human
Target Name
EYA2
Target Full Name
Protein phosphatase EYA2
Target Function
Functions both as protein phosphatase and as transcriptional coactivator for SIX1, and probably also for SIX2, SIX4 and SIX5. Tyrosine phosphatase that dephosphorylates 'Tyr-142' of histone H2AX (H2AXY142ph) and promotes efficient DNA repair via the recruitment of DNA repair complexes containing MDC1. 'Tyr-142' phosphorylation of histone H2AX plays a central role in DNA repair and acts as a mark that distinguishes between apoptotic and repair responses to genotoxic stress. Its function as histone phosphatase may contribute to its function in transcription regulation during organogenesis. Plays an important role in hypaxial muscle development together with SIX1 and DACH2; in this it is functionally redundant with EYA1.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
HAD-like hydrolase superfamily, EYA family
Target Tissue Specificity
Highest expression in muscle with lower levels in kidney, placenta, pancreas, brain and heart.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
EAB 1; EAB1; EYA 2; EYA transcriptional coactivator and phosphatase 2; EYA2; EYA2_HUMAN; eyes absent 2 homolog (Drosophila); Eyes absent homolog 2 (Drosophila); Eyes absent homolog 2; Translation of this uORF probably lowers the translation efficiency of EYA2
Target Background
This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may be post-translationally modified and may play a role in eye development. A similar protein in mice can act as a transcriptional activator. Alternative splicing results in multiple transcript variants, but the full-length natures of all of these variants have not yet been determined.
Notification