-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against F13A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 600-732 of human F13A1 (NP_000120.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against F13A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 600-732 of human F13A1 (NP_000120.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05545A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | F13A1 |
| Target Synonyms | F13A; F13A1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, BxPC-3, Jurkat, Mouse testis, Rat testis, SH-SY5Y | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 600-732 of human F13A1 (NP_000120.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LEQASLHFFVTARINETRDVLAKQKSTVLTIPEIIIKVRGTQVVGSDMTVTVEFTNPLKETLRNVWVHLDGPGVTRPMKKMFREIRPNSTVQWEEVCRPWVSGHRKLIASMSSDSLRHVYGELDVQIQRRPSM | Uniprot ID | P00488 |
Uniprot Id
P00488
Target Species
Human
Target Name
F13A1
Target Full Name
Coagulation factor XIII A chain
Target Function
Factor XIII is activated by thrombin and calcium ion to a transglutaminase that catalyzes the formation of gamma-glutamyl-epsilon-lysine cross-links between fibrin chains, thus stabilizing the fibrin clot. Also cross-link alpha-2-plasmin inhibitor, or fibronectin, to the alpha chains of fibrin.
Target Involvement
Factor XIII subunit A deficiency (FA13AD)
Target Subcellular Location
Cytoplasm. Secreted. Note=Secreted into the blood plasma. Cytoplasmic in most tissues, but also secreted in the blood plasma.
Target Protein Families
Transglutaminase superfamily, Transglutaminase family
Target Research Area
Cardiovascular
Target Synonyms
bA525O21.1 (coagulation factor XIII; A1 polypeptide); Coagulation factor XIII A chain; Coagulation factor XIII A1 polypeptide ; Coagulation factor XIII A1 subunit; Coagulation factor XIII; A polypeptide; Coagulation factor XIIIa; F13A; F13A_HUMAN; F13a1; Factor XIIIA; Fibrin stabilizing factor; A subunit; Fibrinoligase; FSF; A subunit; Protein glutamine gamma glutamyltransferase A chain ; Protein-glutamine gamma-glutamyltransferase A chain; TGase ; Transglutaminase A chain; Transglutaminase; plasma; Transglutaminase. plasma
Target Background
This gene encodes the coagulation factor XIII A subunit. Coagulation factor XIII is the last zymogen to become activated in the blood coagulation cascade. Plasma factor XIII is a heterotetramer composed of 2 A subunits and 2 B subunits. The A subunits have catalytic function, and the B subunits do not have enzymatic activity and may serve as plasma carrier molecules. Platelet factor XIII is comprised only of 2 A subunits, which are identical to those of plasma origin. Upon cleavage of the activation peptide by thrombin and in the presence of calcium ion, the plasma factor XIII dissociates its B subunits and yields the same active enzyme, factor XIIIa, as platelet factor XIII. This enzyme acts as a transglutaminase to catalyze the formation of gamma-glutamyl-epsilon-lysine crosslinking between fibrin molecules, thus stabilizing the fibrin clot. It also crosslinks alpha-2-plasmin inhibitor, or fibronectin, to the alpha chains of fibrin. Factor XIII deficiency is classified into two categories: type I deficiency, characterized by the lack of both the A and B subunits; and type II deficiency, characterized by the lack of the A subunit alone. These defects can result in a lifelong bleeding tendency, defective wound healing, and habitual abortion.
Notification