Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against F8A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human F8A1 (NP_036283.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against F8A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human F8A1 (NP_036283.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05442A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | F8A1 |
| Target Synonyms | F8A; HAP40; DXS522E; F8A1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, Mouse spleen, Rat lung, Rat spleen, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human F8A1 (NP_036283.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ALAVFTRMQRLAREHGSHPVQSLPPPPPPAPQPGPGATPALPAALLPPNSGSAAPSPAALGAFSDVLVRCEVSRVLLLLLLQPPPAKLLPEHAQTLEKYSW | Uniprot ID | P23610 |
Uniprot Id
P23610
Target Species
Human
Target Name
F8A1
Target Full Name
40-kDa huntingtin-associated protein
Target Function
RAB5A effector molecule that is involved in vesicular trafficking of early endosomes. Mediates the recruitment of HTT by RAB5A onto early endosomes. The HTT-F8A1/F8A2/F8A3-RAB5A complex stimulates early endosomal interaction with actin filaments and inhibits interaction with microtubules, leading to the reduction of endosome motility.
Target Subcellular Location
Cytoplasm. Nucleus. Early endosome. Nucleus, nuclear body.
Target Tissue Specificity
Produced abundantly in a wide variety of cell types.
Target Synonyms
Coagulation factor 8 associated (intronic transcript) 1; Coagulation factor VIII associated (intronic transcript) 1; CpG island protein; DXS522E; F8a; F8A1; F8A2; F8A3; F8I2_HUMAN; Factor 8 associated protein; Factor 8 intron 22 protein; Factor VIII associated protein; Factor VIII intron 22 protein; huntingtin associated protein 40
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
