Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FABP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-127 of human FABP1 (NP_001434.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against FABP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-127 of human FABP1 (NP_001434.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11211A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FABP1 |
| Target Synonyms | FABPL; L-FABP; FABP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-127 of human FABP1 (NP_001434.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI | Uniprot ID | P07148 |
Uniprot Id
P07148
Target Species
Human
Target Name
FABP1
Target Full Name
Fatty acid-binding protein, liver
Target Function
Plays a role in lipoprotein-mediated cholesterol uptake in hepatocytes. Binds cholesterol. Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Calycin superfamily, Fatty-acid binding protein (FABP) family
Target Research Area
Signal Transduction
Target Synonyms
Fatty acid-binding protein 1;Liver-type fatty acid-binding protein;L-FABP
Target Background
This gene encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. This protein and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
