Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FABP12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human FABP12 (NP_001098751.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FABP12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human FABP12 (NP_001098751.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06300A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FABP12 |
| Target Synonyms | FABP12 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, Mouse skeletal muscle, Rat spinal cord, Rat testis, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human FABP12 (NP_001098751.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MIDQLQGTWKSISCENSEDYMKELGIGRASRKLGRLAKPTVTISTDGDVITIKTKSIFKNNEISFKLGEEFEEITPGGHKTKSKVTLDKESLIQVQDWDGKETTITRKLVDGKMVVESTVNSVICTRTYEKVSSNSVSNS | Uniprot ID | A6NFH5 |
Uniprot Id
A6NFH5
Target Species
Human
Target Name
FABP12
Target Full Name
Fatty acid-binding protein 12
Target Function
May play a role in lipid transport.
Target Protein Families
Calycin superfamily, Fatty-acid binding protein (FABP) family
Target Tissue Specificity
Expressed in a number of retinoblastoma cell lines.
Target Synonyms
FABP12; Fatty acid binding protein ORF; Fatty acid-binding protein 12; FBP12_HUMAN; Intracellular fatty acid binding protein FABP12; Probable fatty acid binding protein ENSP00000353650
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
