Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FABP4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human FABP4 (P15090) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FABP4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human FABP4 (P15090) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-17028A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FABP4 |
| Target Synonyms | aP2; ALBP; AFABP; A-FABP; HEL-S-104; FABP4 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, Mouse thymus, Rat thymus | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FABP4 (P15090). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDG | Uniprot ID | P15090 |
Uniprot Id
P15090
Target Species
Human
Target Name
FABP4
Target Full Name
Fatty acid-binding protein, adipocyte
Target Function
Lipid transport protein in adipocytes. Binds both long chain fatty acids and retinoic acid. Delivers long-chain fatty acids and retinoic acid to their cognate receptors in the nucleus.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Calycin superfamily, Fatty-acid binding protein (FABP) family
Target Research Area
Cardiovascular
Target Synonyms
3T3-L1 lipid-binding protein; 422/aP2; A-FABP; adipocyte; Adipocyte lipid binding protein; Adipocyte lipid-binding protein; Adipocyte protein AP2; Adipocyte-type fatty acid-binding protein; AFABP; ALBP; ALBP/Ap2; aP2; Epididymis secretory protein Li 104; FABP; FABP4; FABP4_HUMAN; Fatty acid binding protein 4 adipocyte; Fatty acid binding protein 4; Fatty acid binding protein adipocyte; Fatty acid-binding protein 4; Fatty acid-binding protein; HEL S 104; Lbpl; Myelin P2 protein homolog; P15; P2 adipocyte protein; Protein 422
Target Background
FABP4 encodes the fatty acid binding protein found in adipocytes. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
