-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FABP7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-132 of human FABP7 (NP_001437.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against FABP7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-132 of human FABP7 (NP_001437.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11744A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FABP7 |
| Target Synonyms | MRG; BLBP; FABPB; B-FABP; FABP7 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, U-251MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-132 of human FABP7 (NP_001437.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA | Uniprot ID | O15540 |
Uniprot Id
O15540
Target Species
Human
Target Name
FABP7
Target Full Name
Fatty acid-binding protein, brain
Target Function
B-FABP could be involved in the transport of a so far unknown hydrophobic ligand with potential morphogenic activity during CNS development. It is required for the establishment of the radial glial fiber system in developing brain, a system that is necessary for the migration of immature neurons to establish cortical layers.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Calycin superfamily, Fatty-acid binding protein (FABP) family
Target Tissue Specificity
Expressed in brain and other neural tissues.
Target Synonyms
B FABP; B-FABP; BFABP; BLBP; Brain lipid binding protein; Brain lipid-binding protein; Brain-type fatty acid-binding protein; DKFZp547J2313; FABP 7; FABP7; FABP7_HUMAN; FABPB; Fatty Acid Binding Protein 7; Fatty acid binding protein 7 brain; Fatty acid binding protein brain; Fatty acid-binding protein 7; Fatty acid-binding protein, brain; Mammary derived growth inhibitor related ; Mammary-derived growth inhibitor related; MRG; OTTHUMP00000017119
Target Background
The gene encodes a small, highly conserved cytoplasmic protein that bind long-chain fatty acids and other hydrophobic ligands. The encoded protein is important in the establishment of the radial glial fiber in the developing brain. Alternative splicing and promoter usage results in multiple transcript variants encoding different isoforms. Pseudogenes of this gene are found on multiple chromosomes.
Notification