-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FABPI was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human FABPI (P12104) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against FABPI was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human FABPI (P12104) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-13999A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FABPI |
| Target Synonyms | FABPI; I-FABP | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse small intestine, Rat small intestine | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FABPI (P12104). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNG | Uniprot ID | P12104 |
Uniprot Id
P12104
Target Species
Human
Target Name
FABP2
Target Full Name
Fatty acid-binding protein, intestinal
Target Function
FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long-chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Calycin superfamily, Fatty-acid binding protein (FABP) family
Target Tissue Specificity
Expressed in the small intestine and at much lower levels in the large intestine. Highest expression levels in the jejunum.
Target Research Area
Cardiovascular
Target Synonyms
FABP 2; FABP2; FABPI; FABPI_HUMAN; Fatty acid binding protein 2 intestinal; Fatty acid binding protein; Fatty acid binding protein intestinal; Fatty acid-binding protein 2; Fatty acid-binding protein; I FABP; I-FABP; IFABP; intestinal; intestinal FABP; Intestinal fatty acid binding protein 2; Intestinal-type fatty acid-binding protein; MGC133132; OTTHUMP00000163925
Target Background
The protein encoded by this gene is an intracellular fatty acid-binding protein that participates in the uptake, intracellular metabolism, and transport of long-chain fatty acids. The encoded protein is also involved in the modulation of cell growth and proliferation. This protein binds saturated long-chain fatty acids with high affinity, and may act as a lipid sensor to maintain energy homeostasis.
Notification