Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FAM160B2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 420-520 of human FAM160B2 (NP_073586.5) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FAM160B2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 420-520 of human FAM160B2 (NP_073586.5) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04161A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FAM160B2 |
| Target Synonyms | FAI16; RAI16; FAM160B2; RAM160B2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, Mouse brain, Mouse thymus, SH-SY5Y, THP-1 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 420-520 of human FAM160B2 (NP_073586.5). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DRQPEAPGDNPHTLYAHLIGHCDHLSDEISITTLRLFEELLQKPHEGIIHSLVLRNLEGRPYVAWGSPEPESYEDTLDLEEDPYFTDSFLDSGFQTPAKPR | Uniprot ID | Q86V87 |
Uniprot Id
Q86V87
Target Species
Human
Target Name
FHIP2B
Target Full Name
FHF complex subunit HOOK-interacting protein 2B
Target Function
Able to activate MAPK/ERK and TGFB signaling pathways. May regulate the activity of genes involved in intestinal barrier function and immunoprotective inflammation. May play a role in cell proliferation.
Target Protein Families
UPF0518 family
Target Tissue Specificity
Expressed in liver.
Target Synonyms
F16B2_HUMAN; Fam160b2; FLJ11125; FLJ21801; MGC138352 ; Protein FAM160B2; Retinoic acid induced 16; Retinoic acid induced protein 16; Retinoic acid-induced protein 16
Target Background
Able to activate MAPK/ERK and TGFB signaling pathways. May regulate the activity of genes involved in intestinal barrier function and immunoprotective inflammation (By similarity. May play a role in cell proliferation.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
