Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FAM46C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human FAM46C (NP_060179.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FAM46C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human FAM46C (NP_060179.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05518A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FAM46C |
| Target Synonyms | FAM46C | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 5637, DU145, HL-60, HT-29 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human FAM46C (NP_060179.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAEESSCTRDCMSFSVLNWDQVSRLHEVLTEVVPIHGRGNFPTLEITLKDIVQTVRSRLEEAGIKVHDVRLNGSAAGHVLVKDNGLGCKDLDLIFHVALPTEAEFQLVRD | Uniprot ID | Q5VWP2 |
Uniprot Id
Q5VWP2
Target Species
Human
Target Name
TENT5C
Target Full Name
Terminal nucleotidyltransferase 5C
Target Function
Nucleotidyltransferase that act as a non-canonical poly(A) RNA polymerase which enhances mRNA stability and gene expression. Mainly targets mRNAs encoding endoplasmic reticulum-targeted protein and may be involved in induction of cell death.; (Microbial infection) Seems to enhance replication of some viruses, including yellow fever virus, in response to type I interferon.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
FAM46 family
Target Research Area
Cell Biology
Target Synonyms
FA46C_HUMAN; Fam46c; Family with sequence similarity 46 member C; Protein FAM46C
Target Background
Enables RNA adenylyltransferase activity. Involved in mRNA stabilization. Located in cytoplasm and nucleoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
