-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FAM62B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 630-760 of human FAM62B (NP_065779.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FAM62B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 630-760 of human FAM62B (NP_065779.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03270A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FAM62B |
| Target Synonyms | E-Syt2; FAM62B; CHR2SYT | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, HT-29, Mouse liver, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 630-760 of human FAM62B (NP_065779.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EKRERPPDHQHSAQVKRPSVSKEGRKTSIKSHMSGSPGPGGSNTAPSTPVIGGSDKPGMEEKAQPPEAGPQGLHDLGRSSSSLLASPGHISVKEPTPSIASDISLPIATQELRQRLRQLENGTTLGQSPLG | Uniprot ID | A0FGR8 |
Uniprot Id
A0FGR8
Target Species
Human
Target Name
ESYT2
Target Full Name
Extended synaptotagmin-2
Target Function
Tethers the endoplasmic reticulum to the cell membrane and promotes the formation of appositions between the endoplasmic reticulum and the cell membrane. Binds glycerophospholipids in a barrel-like domain and may play a role in cellular lipid transport. Plays a role in FGF signaling via its role in the rapid internalization of FGFR1 that has been activated by FGF1 binding; this occurs most likely via the AP-2 complex. Promotes the localization of SACM1L at endoplasmic reticulum-plasma membrane contact sites (EPCS).
Target Subcellular Location
Cell membrane; Peripheral membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
Extended synaptotagmin family
Target Tissue Specificity
Widely expressed with high level in cerebellum.
Target Research Area
Cell Biology
Target Synonyms
ESYT2; FAM62B; KIAA1228Extended synaptotagmin-2; E-Syt2; Chr2Syt
Target Background
Enables calcium ion binding activity; identical protein binding activity; and phospholipid binding activity. Predicted to be involved in endocytosis; endoplasmic reticulum-plasma membrane tethering; and lipid transport. Located in endoplasmic reticulum-plasma membrane contact site. Is extrinsic component of cytoplasmic side of plasma membrane; integral component of plasma membrane; and intrinsic component of endoplasmic reticulum membrane.
Notification