-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FATP4/SLC27A4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 574-643 of human FATP4/SLC27A4 (NP_005085.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FATP4/SLC27A4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 574-643 of human FATP4/SLC27A4 (NP_005085.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10003A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FATP4/SLC27A4 |
| Target Synonyms | IPS; FATP4; ACSVL4; FATP4/SLC27A4 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 574-643 of human FATP4/SLC27A4 (NP_005085.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PLYARPIFLRLLPELHKTGTYKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL | Uniprot ID | Q6P1M0 |
Uniprot Id
Q6P1M0
Target Species
Human
Target Name
SLC27A4
Target Full Name
Long-chain fatty acid transport protein 4
Target Function
Involved in translocation of long-chain fatty acids (LFCA) across the plasma membrane. Has acyl-CoA ligase activity for long-chain and very-long-chain fatty acids (VLCFAs). Appears to be the principal fatty acid transporter in small intestinal enterocytes. Plays a role in the formation of the epidermal barrier. Required for fat absorption in early embryogenesis. Probably involved in fatty acid transport across the blood barrier. Indirectly inhibits RPE65 via substrate competition and via production of VLCFA derivatives like lignoceroyl-CoA. Prevents light-induced degeneration of rods and cones.
Target Involvement
Ichthyosis prematurity syndrome (IPS)
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
ATP-dependent AMP-binding enzyme family
Target Tissue Specificity
Expressed at highest levels in brain, testis, colon and kidney. Expressed at medium levels in heart and liver, small intestine and stomach. Expressed at low levels in peripheral leukocytes, bone marrow, skeletal muscle and aorta. Expressed in adipose tiss
Target Synonyms
SLC27A4; ACSVL4; FATP4; Long-chain fatty acid transport protein 4; FATP-4; Fatty acid transport protein 4; Arachidonate--CoA ligase; Long-chain-fatty-acid--CoA ligase; Solute carrier family 27 member 4; Very long-chain acyl-CoA synthetase 4; ACSVL4
Target Background
This gene encodes a member of a family of fatty acid transport proteins, which are involved in translocation of long-chain fatty acids cross the plasma membrane. This protein is expressed at high levels on the apical side of mature enterocytes in the small intestine, and appears to be the principal fatty acid transporter in enterocytes. Clinical studies suggest this gene as a candidate gene for the insulin resistance syndrome. Mutations in this gene have been associated with ichthyosis prematurity syndrome.
Notification