-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Fatty Acid Synthase (FASN) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 2400-2500 of human FASN (P49327) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against Fatty Acid Synthase (FASN) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 2400-2500 of human FASN (P49327) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
| Cat.No | ADA-16983A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Fatty Acid Synthase (FASN) |
| Target Synonyms | FAS; OA-519; SDR27X1; Fatty Acid Synthase (FASN) | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A549 | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 2400-2500 of human FASN (P49327). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSS | Uniprot ID | P49327 |
Uniprot Id
P49327
Target Species
Human
Target Name
FASN
Target Full Name
Fatty acid synthase
Target Function
Fatty acid synthetase is a multifunctional enzyme that catalyzes the de novo biosynthesis of long-chain saturated fatty acids starting from acetyl-CoA and malonyl-CoA in the presence of NADPH. This multifunctional protein contains 7 catalytic activities and a site for the binding of the prosthetic group 4'-phosphopantetheine of the acyl carrier protein ([ACP]) domain.
Target Subcellular Location
Cytoplasm. Melanosome. Note=Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
Target Tissue Specificity
Ubiquitous. Prominent expression in brain, lung, liver and mammary gland.
Target Synonyms
[Acyl-carrier-protein] S acetyltransferase; [Acyl-carrier-protein] S malonyltransferase; 3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase; 3-oxoacyl-[acyl-carrier-protein] reductase; 3-oxoacyl-[acyl-carrier-protein] synthase; Enoyl-[acyl-carrier-protein] reductase; FAS; FAS_HUMAN; FASN; Fatty acid synthase; MGC14367; MGC15706; OA 519; Oleoyl-[acyl-carrier-protein] hydrolase; SDR27X1; Short chain dehydrogenase/reductase family 27X member 1
Target Background
The enzyme encoded by this gene is a multifunctional protein. Its main function is to catalyze the synthesis of palmitate from acetyl-CoA and malonyl-CoA, in the presence of NADPH, into long-chain saturated fatty acids. In some cancer cell lines, this protein has been found to be fused with estrogen receptor-alpha (ER-alpha), in which the N-terminus of FAS is fused in-frame with the C-terminus of ER-alpha.
Notification