Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FBLIM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-272 of human FBLIM1 (NP_060026.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FBLIM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-272 of human FBLIM1 (NP_060026.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11359A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FBLIM1 |
| Target Synonyms | CAL; FBLP1; FBLP-1; FBLIM1 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 180-272 of human FBLIM1 (NP_060026.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TDICAFCHKTVSPRELAVEAMKRQYHAQCFTCRTCRRQLAGQSFYQKDGRPLCEPCYQDTLERCGKCGEVVRDHIIRALGQAFHPSCFTCVTC | Uniprot ID | Q8WUP2 |
Uniprot Id
Q8WUP2
Target Species
Human
Target Name
FBLIM1
Target Full Name
Filamin-binding LIM protein 1
Target Function
Serves as an anchoring site for cell-ECM adhesion proteins and filamin-containing actin filaments. Is implicated in cell shape modulation (spreading) and motility. May participate in the regulation of filamin-mediated cross-linking and stabilization of actin filaments. May also regulate the assembly of filamin-containing signaling complexes that control actin assembly. Promotes dissociation of FLNA from ITGB3 and ITGB7. Promotes activation of integrins and regulates integrin-mediated cell-cell adhesion.
Target Subcellular Location
Cell junction, focal adhesion. Cytoplasm, cytoskeleton, stress fiber.
Target Tissue Specificity
Isoform 1 and isoform 3 are expressed in heart, kidney, lung, pancreas, placenta and platelets. Isoform 2 is expressed in brain, heart, kidney, lung, pancreas, placenta, skeletal muscle and platelets.
Target Synonyms
2410043F08Rik; Cal; CSX associated LIM; DKFZp434G171; FBLI1_HUMAN; FBLIM 1; Fblim1; FBLP 1; FBLP-1; FBLP1; Filamin binding LIM protein 1; Filamin-binding LIM protein 1; Gt10; MGC105665; MIG2 interacting protein,; MIG2-interacting protein; Migfilin; Mitogen inducible 2 interacting protein; Mitogen-inducible 2-interacting protein; OTTHUMP00000003118; OTTHUMP00000003119; OTTHUMP00000003120; OTTMUSP00000011062; OTTMUSP00000011063; RP11-169K16.5; RP23-291H3.1
Target Background
This gene encodes a protein with an N-terminal filamin-binding domain, a central proline-rich domain, and, multiple C-terminal LIM domains. This protein localizes at cell junctions and may link cell adhesion structures to the actin cytoskeleton. This protein may be involved in the assembly and stabilization of actin-filaments and likely plays a role in modulating cell adhesion, cell morphology and cell motility. This protein also localizes to the nucleus and may affect cardiomyocyte differentiation after binding with the CSX/NKX2-5 transcription factor. Alternative splicing results in multiple transcript variants encoding different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
