-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FBP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human FBP1 (P09467) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against FBP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human FBP1 (P09467) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14917A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FBP1 |
| Target Synonyms | FBP; FBP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FBP1 (P09467). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MADQAPFDTDVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSTNVTGDQVKKLDVLSNDLVMNMLKSSFATCVLVSEED | Uniprot ID | P09467 |
Uniprot Id
P09467
Target Species
Human
Target Name
FBP1
Target Full Name
Fructose-1,6-bisphosphatase 1
Target Function
Catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate in the presence of divalent cations, acting as a rate-limiting enzyme in gluconeogenesis. Plays a role in regulating glucose sensing and insulin secretion of pancreatic beta-cells. Appears to modulate glycerol gluconeogenesis in liver. Important regulator of appetite and adiposity; increased expression of the protein in liver after nutrient excess increases circulating satiety hormones and reduces appetite-stimulating neuropeptides and thus seems to provide a feedback mechanism to limit weight gain.
Target Involvement
Fructose-1,6-bisphosphatase deficiency (FBP1D)
Target Protein Families
FBPase class 1 family
Target Tissue Specificity
Expressed in pancreatic islets.
Target Research Area
Signal Transduction, Epigenetics and Nuclear Signaling
Target Synonyms
6-bisphosphatase 1; 6-bisphosphate 1-phosphohydrolase 1; D fructose 1 6 bisphosphate 1 phosphohydrolase 1; D-fructose-1; EC 3.1.3.11; F16P1_HUMAN; FBP; FBP 1; FBP1; FBPase 1; Fructose 1 6 bisphosphatase 1; Fructose bisphosphatase 1; Fructose-1; Growth inhibiting protein 17; Liver fructose bisphosphatase
Target Background
Fructose-1, 6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1, 6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1, 6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.
Notification