-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FBXO8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-250 of human FBXO8 (NP_036312.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FBXO8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-250 of human FBXO8 (NP_036312.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07014A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FBXO8 |
| Target Synonyms | FBS; DC10; FBX8; FBXO8 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 110-250 of human FBXO8 (NP_036312.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GLCKSTWGHCSIYNKNPPLGFSFRKLYMQLDEGSLTFNANPDEGVNYFMSKGILDDSPKEIAKFIFCTRTLNWKKLRIYLDERRDVLDDLVTLHNFRNQFLPNALREFFRHIHAPEERGEYLETLITKFSHRFCACNPDLM | Uniprot ID | Q9NRD0 |
Uniprot Id
Q9NRD0
Target Species
Human
Target Name
FBXO8
Target Full Name
F-box only protein 8
Target Function
May promote guanine-nucleotide exchange on an ARF. Promotes the activation of ARF through replacement of GDP with GTP (Potential).
Target Synonyms
DC10; F box only protein 8; F box protein 8; F box protein Fbx8; F box/SEC7 protein FBS; F-box only protein 8; F-box/SEC7 protein FBS; FBS; FBX8; FBX8_HUMAN; FBXO 8; Fbxo8
Target Background
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. It contains a C-terminal amino acid sequence that bears a significant similarity with a portion of yeast Sec7p, a critical regulator of vesicular protein transport. This human protein may interact with ADP-ribosylation factor(s)(ARFs) and exhibit ARF-GEF (guanine nucleotide exchange factor) activity.
Notification