Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FBXW8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-598 of human FBXW8 (NP_699179.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against FBXW8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-598 of human FBXW8 (NP_699179.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10546A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FBXW8 |
| Target Synonyms | FBW6; FBW8; FBX29; FBXW6; FBXO29; FBXW8 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart, A-431, A-549, Rat lung, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 500-598 of human FBXW8 (NP_699179.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | WDYRMNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNADLDSFTTHRRHRGLIRAYEFAVDQLAFQSPLPVCRSSCDAMATHYYDLALAFPYNHV | Uniprot ID | Q8N3Y1 |
Uniprot Id
Q8N3Y1
Target Species
Human
Target Name
FBXW8
Target Full Name
F-box/WD repeat-containing protein 8
Target Function
Substrate-recognition component of a Cul7-RING ubiquitin-protein ligase complex, which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. The Cul7-RING(FBXW8) complex mediates ubiquitination and consequent degradation of GORASP1, acting as a component of the ubiquitin ligase pathway that regulates Golgi morphogenesis and dendrite patterning in brain. Mediates ubiquitination and degradation of IRS1 in a mTOR-dependent manner: the Cul7-RING(FBXW8) complex recognizes and binds IRS1 previously phosphorylated by S6 kinase (RPS6KB1 or RPS6KB2). The Cul7-RING(FBXW8) complex also mediates ubiquitination of MAP4K1/HPK1: recognizes and binds autophosphorylated MAP4K1/HPK1, leading to its degradation, thereby affecting cell proliferation and differentiation. Associated component of the 3M complex, suggesting that it mediates some of 3M complex functions
Target Subcellular Location
Cytoplasm, perinuclear region. Golgi apparatus.
Target Synonyms
F box and WD40 domain containing protein 8; F box only protein 29; F box/WD repeat containing protein 8; F-box and WD-40 domain-containing protein 8; F-box only protein 29; F-box/WD repeat-containing protein 8; FBW6; FBW8; FBX29; FBXO29; FBXW6; FBXW8; FBXW8_HUMAN
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
