Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FCF1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-198 of human FCF1 (NP_057046.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against FCF1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-198 of human FCF1 (NP_057046.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-06077A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FCF1 |
| Target Synonyms | Bka; UTP24; CGI-35; C14orf111; FCF1 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-198 of human FCF1 (NP_057046.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PCITDCVMAEIEKLGQKYRVALRIAKDPRFERLPCTHKGTYADDCLVQRVTQHKCYIVATVDRDLKRRIRKIPGVPIMYISNHRYNIERMPDDYGAPRF | Uniprot ID | Q9Y324 |
Uniprot Id
Q9Y324
Target Species
Human
Target Name
FCF1
Target Full Name
rRNA-processing protein FCF1 homolog
Target Function
Essential protein involved in pre-rRNA processing and 40S ribosomal subunit assembly.
Target Subcellular Location
Nucleus, nucleolus.
Target Protein Families
UTP23/FCF1 family, FCF1 subfamily
Target Synonyms
Bka; C14orf111; CGI 35; Fcf1; FCF1 small subunit (SSU) processome component homolog (S. cerevisiae); FCF1_HUMAN; rRNA processing protein FCF1 homolog; rRNA-processing protein FCF1 homolog
Target Background
Enables RNA binding activity. Predicted to be involved in rRNA processing. Predicted to act upstream of or within endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) and endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA). Predicted to be located in nucleoplasm. Predicted to be part of small-subunit processome. Predicted to be active in nucleolus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
