Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FCGR2C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 43-223 of human FCGR2C (NP_963857.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FCGR2C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 43-223 of human FCGR2C (NP_963857.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01227A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FCGR2C |
| Target Synonyms | CD32; FCG2; CD32C; CDW32; IGFR2; FCRIIC; FcgammaRIIc; FCGR2C | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 22Rv1, THP-1 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 43-223 of human FCGR2C (NP_963857.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIPWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMG | Uniprot ID | P31995 |
Uniprot Id
P31995
Target Species
Human
Target Name
FCGR2C
Target Full Name
Low affinity immunoglobulin gamma Fc region receptor II-c
Target Function
Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells.
Target Subcellular Location
[Isoform IIC4]: Cytoplasm.; [Isoform IIC3]: Cell membrane; Single-pass type I membrane protein.; [Isoform IIC2]: Cell membrane; Single-pass type I membrane protein.; [Isoform IIC1]: Cell membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Isoform IIC1 is detected in monocytes, macrophages, polymorphonuclear cells and natural killer cells.
Target Synonyms
FCGR2C; CD32; FCG2; IGFR2; Low affinity immunoglobulin gamma Fc region receptor II-c; IgG Fc receptor II-c; CDw32; Fc-gamma RII-c; Fc-gamma-RIIc; FcRII-c; CD antigen CD32
Target Background
This gene encodes one of three members of a family of low-affinity immunoglobulin gamma Fc receptors found on the surface of many immune response cells. The encoded protein is a transmembrane glycoprotein and may be involved in phagocytosis and clearing of immune complexes. An allelic polymorphism in this gene results in both coding and non-coding variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
