-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FCRL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-100 of human FCRL2 (Q96LA5) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FCRL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-100 of human FCRL2 (Q96LA5) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01423A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FCRL2 |
| Target Synonyms | FCRH2; IFGP4; IRTA4; SPAP1; CD307b; SPAP1A; SPAP1B; SPAP1C; FCRL2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Raji | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-100 of human FCRL2 (Q96LA5). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LTLVAPSSVFEGDSIVLKCQGEQNWKIQKMAYHKDNKELSVFKKFSDFLIQSAVLSDSGNYFCSTKGQLFLWDKTSNIVKI | Uniprot ID | Q96LA5 |
Uniprot Id
Q96LA5
Target Species
Human
Target Name
FCRL2
Target Full Name
Fc receptor-like protein 2
Target Function
May have an regulatory role in normal and neoplastic B cell development.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Expressed in the secondary lymphoid organs, spleen and lymph node. Expression is limited to the mature B-cell lines. Highly expressed in CD19 and within the mantle zones of the tonsil tissue. Isoform 2 is expressed in the spleen, peripheral blood and bone
Target Synonyms
CD307b; Fc receptor homolog 2; Fc receptor like protein 2; Fc receptor-like protein 2; FcR-like protein 2; FcRH2; FCRL 2; FcRL2; FCRL2_HUMAN; IFGP family protein 4; IFGP4; Immunoglobulin receptor translocation associated 4 protein ; Immunoglobulin receptor translocation-associated protein 4; IRTA4; SH2 domain containing phosphatase anchor protein 1; SH2 domain-containing phosphatase anchor protein 1; SPAP1
Target Background
This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein has four extracellular C2-type immunoglobulin domains, a transmembrane domain and a cytoplasmic domain that contains one immunoreceptor-tyrosine activation motif and two immunoreceptor-tyrosine inhibitory motifs. This protein may be a prognostic marker for chronic lymphocytic leukemia. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.
Notification