Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FGD1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 700-800 of human FGD1 (NP_004454.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FGD1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 700-800 of human FGD1 (NP_004454.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01585A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FGD1 |
| Target Synonyms | AAS; FGDY; MRXS16; ZFYVE3; FGD1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 700-800 of human FGD1 (NP_004454.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LLNSTNREDEDTPPNSPNVDLGKRAPTPIREKEVTMCMRCQEPFNSITKRRHHCKACGHVVCGKCSEFRARLVYDNNRSNRVCTDCYVALHGVPGSSPACS | Uniprot ID | P98174 |
Uniprot Id
P98174
Target Species
Human
Target Name
FGD1
Target Full Name
FYVE, RhoGEF and PH domain-containing protein 1
Target Function
Activates CDC42, a member of the Ras-like family of Rho- and Rac proteins, by exchanging bound GDP for free GTP. Plays a role in regulating the actin cytoskeleton and cell shape.
Target Involvement
Aarskog-Scott syndrome (AAS)
Target Subcellular Location
Cytoplasm. Cell projection, lamellipodium. Cell projection, ruffle. Cytoplasm, cytoskeleton.
Target Tissue Specificity
Expressed in fetal heart, brain, lung, kidney and placenta. Less expressed in liver; adult heart, brain, lung, pancreas and skeletal muscle.
Target Synonyms
AAS; Faciogenital dysplasia 1 protein; FGD1; FGD1_HUMAN; FGDY; FYVE RhoGEF and PH domain containing protein 1; FYVE; RhoGEF and PH domain-containing protein 1; Rho/Rac GEF; Rho/Rac guanine nucleotide exchange factor FGD1; ZFYVE3; Zinc finger FYVE domain containing protein 3; Zinc finger FYVE domain-containing protein 3
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
