Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FGF3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human FGF3 (NP_005238.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FGF3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human FGF3 (NP_005238.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11223A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | fgf3 |
| Target Synonyms | INT2; HBGF-3; FGF3 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FGF3 (NP_005238.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGLIWLLLLSLLEPGWPAAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHPSGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMN | Uniprot ID | P11487 |
Uniprot Id
P11487
Target Species
Human
Target Name
FGF3
Target Full Name
Fibroblast growth factor 3
Target Function
Plays an important role in the regulation of embryonic development, cell proliferation, and cell differentiation. Required for normal ear development.
Target Involvement
Deafness with labyrinthine aplasia, microtia and microdontia (LAMM)
Target Subcellular Location
Secreted.
Target Protein Families
Heparin-binding growth factors family
Target Research Area
Others
Target Synonyms
FGF3; INT2Fibroblast growth factor 3; FGF-3; Heparin-binding growth factor 3; HBGF-3; Proto-oncogene Int-2
Target Background
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was identified by its similarity with mouse fgf3/int-2, a proto-oncogene activated in virally induced mammary tumors in the mouse. Frequent amplification of this gene has been found in human tumors, which may be important for neoplastic transformation and tumor progression. Studies of the similar genes in mouse and chicken suggested the role in inner ear formation.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
