-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FGF6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human FGF6 (NP_066276.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FGF6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human FGF6 (NP_066276.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06822A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FGF6 |
| Target Synonyms | HST2; HBGF-6; FGF6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat skeletal muscle | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FGF6 (NP_066276.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MALGQKLFITMSRGAGRLQGTLWALVFLGILVGMVVPSPAGTRANNTLLDSRGWGTLLSRSRAGLAGEIAGVNWESGYLVGIKRQRRLYCNVGIGFHLQV | Uniprot ID | P10767? |
Uniprot Id
P10767
Target Species
Human
Target Name
FGF6
Target Full Name
Fibroblast growth factor 6
Target Function
Plays an important role in the regulation of cell proliferation, cell differentiation, angiogenesis and myogenesis, and is required for normal muscle regeneration.
Target Subcellular Location
Secreted, extracellular space.
Target Protein Families
Heparin-binding growth factors family
Target Tissue Specificity
Leukemia cell lines with platelet/ megakaryocytic differentiation potential.
Target Synonyms
FGF 6; FGF-6; Fgf6; FGF6_HUMAN; Fibroblast growth factor 6; Fibroblast growth factor 6 precursor; HBGF 6; HBGF-6; HBGF6; Heparin secretory-transforming protein 2; Heparin-binding growth factor 6; HST 2 ; HST-2; HST2 ; HSTF-2
Target Background
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene displayed oncogenic transforming activity when transfected into mammalian cells. The mouse homolog of this gene exhibits a restricted expression profile predominantly in the myogenic lineage, which suggested a role in muscle regeneration or differentiation.
Notification