-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FGFR1OP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human FGFR1OP (NP_919410.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FGFR1OP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human FGFR1OP (NP_919410.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06981A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FGFR1OP |
| Target Synonyms | FOP; FGFR1OP | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human FGFR1OP (NP_919410.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNESLKKFLNTKD | Uniprot ID | O95684 |
Uniprot Id
O95684
Target Species
Human
Target Name
CEP43
Target Full Name
Centrosomal protein 43
Target Function
Required for anchoring microtubules to the centrosomes. Required for ciliation.
Target Involvement
A chromosomal aberration involving FGFR1OP may be a cause of stem cell myeloproliferative disorder (MPD). Translocation t(6;8)(q27;p11) with FGFR1. MPD is characterized by myeloid hyperplasia, eosinophilia and T-cell or B-cell lymphoblastic lymphoma. In general it progresses to acute myeloid leukemia. The fusion proteins FGFR1OP-FGFR1 or FGFR1-FGFR1OP may exhibit constitutive kinase activity and be responsible for the transforming activity (PubMed:9949182).
Target Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole. Cytoplasm, cytoskeleton, cilium basal body.
Target Protein Families
FGFR1OP family
Target Tissue Specificity
Ubiquitous. Highly expressed in heart, liver, muscle, kidney, intestine, colon, adrenal gland, prostate, testis, and pancreas.
Target Synonyms
FGFR1 oncogene partner; FGFR1OP; Fibroblast growth factor receptor 1 oncogene partner; FOP; FR1OP_HUMAN; OTTHUMP00000017612; OTTHUMP00000017613
Target Background
This gene encodes a largely hydrophilic centrosomal protein that is required for anchoring microtubules to subcellular structures. A t(6;8)(q27;p11) chromosomal translocation, fusing this gene and the fibroblast growth factor receptor 1 (FGFR1) gene, has been found in cases of myeloproliferative disorder. The resulting chimeric protein contains the N-terminal leucine-rich region of this encoded protein fused to the catalytic domain of FGFR1. Alterations in this gene may also be associated with Crohn's disease, Graves' disease, and vitiligo. Alternatively spliced transcript variants that encode different proteins have been identified.
Notification