-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FHOD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1010-1120 of human FHOD1 (NP_037373.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FHOD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1010-1120 of human FHOD1 (NP_037373.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05058A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FHOD1 |
| Target Synonyms | FHOS; FHOD1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1010-1120 of human FHOD1 (NP_037373.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TRGRMITETEKFSGVAGEAPSNPSVPVAVSSGPGRGDADSHASMKSLLTSRPEDTTHNRRSRGMVQSSSPIMPTVGPSTASPEEPPGSSLPSDTSDEIMDLLVQSVTKSSP | Uniprot ID | Q9Y613 |
Uniprot Id
Q9Y613
Target Species
Human
Target Name
FHOD1
Target Full Name
FH1/FH2 domain-containing protein 1
Target Function
Required for the assembly of F-actin structures, such as stress fibers. Depends on the Rho-ROCK cascade for its activity. Contributes to the coordination of microtubules with actin fibers and plays a role in cell elongation. Acts synergistically with ROCK1 to promote SRC-dependent non-apoptotic plasma membrane blebbing.
Target Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton. Cell projection, bleb. Note=Predominantly cytoplasmic.
Target Protein Families
Formin homology family
Target Tissue Specificity
Ubiquitous. Highly expressed in spleen.
Target Synonyms
FH1/FH2 domain containing protein ; FH1/FH2 domain containing protein 1; FH1/FH2 domain-containing protein 1; Fhod1; FHOD1_HUMAN; FHOS; FHOS1; Formin homolog overexpressed in spleen 1; Formin homology 2 domain containing 1; Formin homology 2 domain containing protein 1 ; Formin homology 2 domain-containing protein 1
Target Background
This gene encodes a protein which is a member of the formin/diaphanous family of proteins. The gene is ubiquitously expressed but is found in abundance in the spleen. The encoded protein has sequence homology to diaphanous and formin proteins within the Formin Homology (FH)1 and FH2 domains. It also contains a coiled-coil domain, a collagen-like domain, two nuclear localization signals, and several potential PKC and PKA phosphorylation sites. It is a predominantly cytoplasmic protein and is expressed in a variety of human cell lines. Alternative splicing results in multiple transcript variants.
Notification