Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Fibrinogen alpha chain (FGA) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 700-800 of human Fibrinogen alpha chain (FGA) (FGA) (P02671) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Fibrinogen alpha chain (FGA) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 700-800 of human Fibrinogen alpha chain (FGA) (FGA) (P02671) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16248A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Fibrinogen alpha chain (FGA) |
| Target Synonyms | Fib2; Fibrinogen alpha chain (FGA) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 700-800 of human Fibrinogen alpha chain (FGA) (FGA) (P02671). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NDEGEGEFWLGNDYLHLLTQRGSVLRVELEDWAGNEAYAEYHFRVGSEAEGYALQVSSYEGTAGDALIEGSVEEGAEYTSHNNMQFSTFDRDADQWEENCA | Uniprot ID | P02671 |
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
