-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FKBP1B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-80 of human FKBP1B (NP_473374.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against FKBP1B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-80 of human FKBP1B (NP_473374.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-01054A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FKBP1B |
| Target Synonyms | OTK4; FKBP1L; PKBP1L; PPIase; FKBP12.6; FKBP1B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-80 of human FKBP1B (NP_473374.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPLSPLPICPHPC | Uniprot ID | P68106 |
Uniprot Id
P68106
Target Species
Human
Target Name
FKBP1B
Target Full Name
Peptidyl-prolyl cis-trans isomerase FKBP1B
Target Function
Has the potential to contribute to the immunosuppressive and toxic effects of FK506 and rapamycin. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Target Subcellular Location
Cytoplasm. Sarcoplasmic reticulum.
Target Protein Families
FKBP-type PPIase family, FKBP1 subfamily
Target Tissue Specificity
Detected in heart muscle (at protein level). Isoform 1 and isoform 2 are ubiquitous with highest levels in brain and thymus.
Target Synonyms
12.6 kDa FK506-binding protein; 12.6 kDa FKBP; Calstabin 2; FK506 binding protein 1 like; FK506 binding protein 12.6; FK506 binding protein 1B 12.6 kDa; FK506 binding protein 1B; FK506-binding protein 1B; FKB1B_HUMAN; FKBP 12.6; FKBP 1B; FKBP 1L; FKBP 9; FKBP-12.6; FKBP-1B; FKBP12.6; Fkbp1b; FKBP1L; FKBP9; h FKBP 12; h-FKBP-12; Immunophilin FKBP12.6; OTK 4; OTK4; Peptidyl prolyl cis trans isomerase 1B; Peptidyl prolyl cis trans isomerase; Peptidyl-prolyl cis-trans isomerase FKBP1B; PKBP 1L; PKBP1L; PPIase 1B; PPIase; PPIase FKBP1B; Rotamase 1B; Rotamase
Target Background
The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is highly similar to the FK506-binding protein 1A. Its physiological role is thought to be in excitation-contraction coupling in cardiac muscle. There are two alternatively spliced transcript variants of this gene encoding different isoforms.
Notification