-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FKBP52/FKBP4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human FKBP4 (Q02790) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against FKBP52/FKBP4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human FKBP4 (Q02790) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13850A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FKBP52/FKBP4 |
| Target Synonyms | HBI; p52; Hsp56; FKBP51; FKBP52; FKBP59; PPIase; FKBP52/FKBP4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Jurkat, Mouse testis, Mouse thymus, Rat testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human FKBP4 (Q02790). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTAEEMKATESGAQSAPLPMEGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDI | Uniprot ID | Q02790 |
Uniprot Id
Q02790
Target Species
Human
Target Name
FKBP4
Target Full Name
Peptidyl-prolyl cis-trans isomerase FKBP4
Target Function
Immunophilin protein with PPIase and co-chaperone activities. Component of steroid receptors heterocomplexes through interaction with heat-shock protein 90 (HSP90). May play a role in the intracellular trafficking of heterooligomeric forms of steroid hormone receptors between cytoplasm and nuclear compartments. The isomerase activity controls neuronal growth cones via regulation of TRPC1 channel opening. Acts also as a regulator of microtubule dynamics by inhibiting MAPT/TAU ability to promote microtubule assembly. May have a protective role against oxidative stress in mitochondria.
Target Subcellular Location
Cytoplasm, cytosol. Mitochondrion. Nucleus. Cytoplasm, cytoskeleton. Cell projection, axon.
Target Tissue Specificity
Widely expressed.
Target Synonyms
51 kDa FK506-binding protein; 52 kDa FK506 binding protein; 52 kDa FK506-binding protein; 52 kDa FKBP; 59 kDa immunophilin; FK506 binding protein 4; FK506-binding protein 4; FKBP 4; FKBP 52; FKBP 59; FKBP-4; FKBP-52; FKBP4; FKBP4_HUMAN; FKBP51; FKBP52 protein; FKBP59; HBI; Hsp 56; HSP binding immunophilin; HSP-binding immunophilin; Hsp56; Immunophilin FKBP52; N-terminally processed; p52; p59; p59 protein; Peptidyl prolyl cis trans isomerase; peptidyl-prolyl cis-trans isomerase; Peptidyl-prolyl cis-trans isomerase FKBP4; Peptidylprolyl cis trans isomerase; PPIase; PPIase FKBP4; Rotamase; T cell FK506 binding protein 59kD
Target Background
The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It has high structural and functional similarity to FK506-binding protein 1A (FKBP1A), but unlike FKBP1A, this protein does not have immunosuppressant activity when complexed with FK506. It interacts with interferon regulatory factor-4 and plays an important role in immunoregulatory gene expression in B and T lymphocytes. This encoded protein is known to associate with phytanoyl-CoA alpha-hydroxylase. It can also associate with two heat shock proteins (hsp90 and hsp70) and thus may play a role in the intracellular trafficking of hetero-oligomeric forms of the steroid hormone receptors. This protein correlates strongly with adeno-associated virus type 2 vectors (AAV) resulting in a significant increase in AAV-mediated transgene expression in human cell lines. Thus this encoded protein is thought to have important implications for the optimal use of AAV vectors in human gene therapy. The human genome contains several non-transcribed pseudogenes similar to this gene.
Notification