Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FLAD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 388-587 of human FLAD1 (NP_079483.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FLAD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 388-587 of human FLAD1 (NP_079483.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05745A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FLAD1 |
| Target Synonyms | FAD1; FADS; PP591; LSMFLAD; FLAD1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 388-587 of human FLAD1 (NP_079483.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ETSLAQYSLTQLCVGFNGGKDCTALLHLFHAAVQRKLPDVPNPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQLEAVLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLLDWTYRDIWDFLRQLFVPYCILYDRGYTSLGSRENTVRNPALKCLSPGGHPTYRPAYLLENEEEERNSRT | Uniprot ID | Q8NFF5 |
Uniprot Id
Q8NFF5
Target Species
Human
Target Name
FLAD1
Target Full Name
FAD synthase
Target Function
Catalyzes the adenylation of flavin mononucleotide (FMN) to form flavin adenine dinucleotide (FAD) coenzyme.
Target Involvement
Lipid storage myopathy due to flavin adenine dinucleotide synthetase deficiency (LSMFLAD)
Target Subcellular Location
[Isoform 1]: Mitochondrion matrix.; [Isoform 2]: Cytoplasm.
Target Protein Families
MoaB/Mog family; PAPS reductase family, FAD1 subfamily
Target Research Area
Metabolism
Target Synonyms
FLAD1; PP591FAD synthase; EC 2.7.7.2; FAD pyrophosphorylase; FMN adenylyltransferase; Flavin adenine dinucleotide synthase) [Includes: Molybdenum cofactor biosynthesis protein-like region; FAD synthase region]
Target Background
This gene encodes the enzyme that catalyzes adenylation of flavin mononucleotide (FMN) to form flavin adenine dinucleotide (FAD) coenzyme. Alternatively spliced transcript variants encoding distinct isoforms have been observed.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
