Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FLG was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human FLG (NP_002007.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FLG was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human FLG (NP_002007.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07360A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FLG |
| Target Synonyms | FLG1; ATOD2; FLG-1; FLG | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Mouse stomach, NTERA-2, Rat liver, Rat stomach, U2OS | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human FLG (NP_002007.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSTLLENIFAIINLFKQYSKKDKNTDTLSKKELKELLEKEFRQILKNPDDPDMVDVFMDHLDIDHNKKIDFTEFLLMVFKLAQAYYESTRKE | Uniprot ID | P20930 |
Uniprot Id
P20930
Target Species
Human
Target Name
FLG
Target Full Name
Filaggrin
Target Function
Aggregates keratin intermediate filaments and promotes disulfide-bond formation among the intermediate filaments during terminal differentiation of mammalian epidermis.
Target Involvement
Ichthyosis vulgaris (VI); Dermatitis atopic 2 (ATOD2)
Target Subcellular Location
Cytoplasmic granule.
Target Protein Families
S100-fused protein family
Target Tissue Specificity
Expressed in skin, thymus, stomach, tonsils, testis, placenta, kidney, pancreas, mammary gland, bladder, thyroid, salivary gland and trachea, but not detected in heart, brain, liver, lung, bone marrow, small intestine, spleen, prostate, colon, or adrenal
Target Research Area
Signal Transduction, Cancer
Target Synonyms
ATOD2; Epidermal filaggrin; FILA_HUMAN; Filaggrin; Filaggrin precursor; Fillagrin; FLG; Profilaggrin
Target Background
The protein encoded by this gene is an intermediate filament-associated protein that aggregates keratin intermediate filaments in mammalian epidermis. It is initially synthesized as a polyprotein precursor, profilaggrin (consisting of multiple filaggrin units of 324 aa each), which is localized in keratohyalin granules, and is subsequently proteolytically processed into individual functional filaggrin molecules. Mutations in this gene are associated with ichthyosis vulgaris.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
