Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FLJ12529 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-240 of human FLJ12529 (NP_079087.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FLJ12529 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-240 of human FLJ12529 (NP_079087.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05969A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FLJ12529 |
| Target Synonyms | CFIm59; FLJ12529 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, Jurkat, Mouse thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 50-240 of human FLJ12529 (NP_079087.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LIDIYADEEFNQDPEFNNTDQIDLYDDVLTATSQPSDDRSSSTEPPPPVRQEPSPKPNNKTPAILYTYSGLRNRRAAVYVGSFSWWTTDQQLIQVIRSIGVYDVVELKFAENRANGQSKGYAEVVVASENSVHKLLELLPGKVLNGEKVDVRPATRQNLSQFEAQARKRECVRVPRGGIPPRAHSRDSSDS | Uniprot ID | Q8N684 |
Uniprot Id
Q8N684
Target Species
Human
Target Name
CPSF7
Target Full Name
Cleavage and polyadenylation specificity factor subunit 7
Target Function
Component of the cleavage factor Im (CFIm) complex that functions as an activator of the pre-mRNA 3'-end cleavage and polyadenylation processing required for the maturation of pre-mRNA into functional mRNAs. CFIm contributes to the recruitment of multiprotein complexes on specific sequences on the pre-mRNA 3'-end, so called cleavage and polyadenylation signals (pA signals). Most pre-mRNAs contain multiple pA signals, resulting in alternative cleavage and polyadenylation (APA) producing mRNAs with variable 3'-end formation. The CFIm complex acts as a key regulator of cleavage and polyadenylation site choice during APA through its binding to 5'-UGUA-3' elements localized in the 3'-untranslated region (UTR) for a huge number of pre-mRNAs. CPSF7 activates directly the mRNA 3'-processing machinery. Binds to pA signals in RNA substrates
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
RRM CPSF6/7 family
Target Synonyms
CFIm59; Cleavage and polyadenylation specificity factor 59 kDa subunit; Cleavage and polyadenylation specificity factor 7; Cleavage and polyadenylation specificity factor subunit 7; CPSF 59 kDa subunit; Cpsf7; CPSF7_HUMAN; FLJ12529 pre mRNA cleavage factor I 59 kDa subunit; FLJ39024; MGC9315; Pre mRNA cleavage factor Im 59 kDa subunit; Pre-mRNA cleavage factor Im 59 kDa subunit
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
