Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Flotillin 1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 328-427 of human Flotillin 1 (O75955) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Flotillin 1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 328-427 of human Flotillin 1 (O75955) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16573A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Flotillin 1 |
| Target Synonyms | FLOT1; flotillin-1; Flotillin 1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, Rat heart, A-549, Mouse brain, Mouse lung | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 328-427 of human Flotillin 1 (O75955). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVSISQVNHKPLRTA | Uniprot ID | O75955 |
Uniprot Id
O75955
Target Species
Human
Target Name
FLOT1
Target Full Name
Flotillin-1
Target Function
May act as a scaffolding protein within caveolar membranes, functionally participating in formation of caveolae or caveolae-like vesicles.
Target Subcellular Location
Cell membrane; Peripheral membrane protein. Endosome. Membrane, caveola; Peripheral membrane protein. Melanosome. Membrane raft.
Target Protein Families
Band 7/mec-2 family, Flotillin subfamily
Target Research Area
Cell Biology
Target Synonyms
FLOT 1; FLOT1; FLOT1_HUMAN; Flotillin-1; Flotillin1; Integral membrane component of caveolae; Reggie 2
Target Background
This gene encodes an protein that localizes to the caveolae, which are small domains on the inner cell membranes. This protein plays a role in vesicle trafficking and cell morphology. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
