Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FMN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-495 of human FMN1 (NP_001096654.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FMN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-495 of human FMN1 (NP_001096654.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03460A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FMN1 |
| Target Synonyms | LD; FMN; FMN1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-549, LO2, Mouse testis, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 350-495 of human FMN1 (NP_001096654.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NIDMPKTEPKGADPESPRREEMGCNADQESQSGPGVPQTQGGEVKPKSPETALEAFKALFIRPPRKGTTADTSELEALKRKMRHEKESLRAVFERSNSKPADGPSDSKSPDHSLTEQDDRTPGRLQAVWPPPKTKDTEEKVGLKYT | Uniprot ID | Q68DA7 |
Uniprot Id
Q68DA7
Target Species
Human
Target Name
FMN1
Target Full Name
Formin-1
Target Function
Plays a role in the formation of adherens junction and the polymerization of linear actin cables.
Target Subcellular Location
Nucleus. Cytoplasm. Cell junction, adherens junction. Cell membrane; Peripheral membrane protein; Cytoplasmic side.
Target Protein Families
Formin homology family, Cappuccino subfamily
Target Synonyms
FMN1; FMN; LDFormin-1; Limb deformity protein homolog
Target Background
This gene belongs to the formin homology family and encodes a protein that has a role in the formation of adherens junction and the polymerization of linear actin cables. The homologous gene in mouse is associated with limb deformity. Alternatively spliced transcript variants have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
