Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FNDC4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 45-167 of human FNDC4 (NP_073734.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against FNDC4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 45-167 of human FNDC4 (NP_073734.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
Immunohistochemistry analysis of FNDC4 in paraffin-embedded human colon using FNDC4 Rabbit pAb at dilution of 1:150 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
| Cat.No | ADA-07075A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FNDC4 |
| Target Synonyms | FRCP1; FNDC4 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 45-167 of human FNDC4 (NP_073734.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DRPPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQT | Uniprot ID | Q9H6D8 |
Uniprot Id
Q9H6D8
Target Species
Human
Target Name
FNDC4
Target Full Name
Fibronectin type III domain-containing protein 4
Target Function
Acts as an anti-inflammatory factor in the intestine and colon. Binds to and acts on macrophages to downregulate pro-inflammatory gene expression. Affects key macrophage functions, including phagocytosis, by downregulating many key pathways for macrophage activation, partly via by STAT3 activation and signaling. May be required to dampen the immunological response in colitis.
Target Subcellular Location
Membrane; Single-pass type I membrane protein. Secreted.
Target Tissue Specificity
Up-regulated in colon cells of patients with inflammatory bowel disease (IBD).
Target Synonyms
Fibronectin type III domain containing 4; Fibronectin type III domain containing protein 4; Fibronectin type III domain-containing protein 4; Fibronectin type III repeat containing protein 1; Fibronectin type III repeat-containing protein 1; FLJ22362; FNDC 4; FNDC4; FNDC4_HUMAN; FRCP 1; FRCP1
Target Background
Involved in response to transforming growth factor beta. Predicted to be located in endoplasmic reticulum and extracellular space. Predicted to be active in extracellular region and plasma membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
