-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FOXI1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human FOXI1 (NP_036320.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FOXI1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human FOXI1 (NP_036320.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03916A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FOXI1 |
| Target Synonyms | HFH3; FKH10; HFH-3; FKHL10; FREAC6; FREAC-6; FOXI1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat kidney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FOXI1 (NP_036320.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSSFDLPAPSPPRCSPQFPSIGQEPPEMNLYYENFFHPQGVPSPQRPSFEGGGEYGATPNPYLWFNGPTMTPPPYLPGPNASPFLPQAYGVQRPLLPSVS | Uniprot ID | Q12951 |
Uniprot Id
Q12951
Target Species
Human
Target Name
FOXI1
Target Full Name
Forkhead box protein I1
Target Function
Transcriptional activator required for the development of normal hearing, sense of balance and kidney function. Required for the expression of SLC26A4/PDS, JAG1 and COCH in a subset of epithelial cells and the development of the endolymphatic system in the inner ear. Also required for the expression of SLC4A1/AE1, SLC4A9/AE4, ATP6V1B1 and the differentiation of intercalated cells in the epithelium of distal renal tubules.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Expressed in kidney.
Target Synonyms
FKH10; FKHL10; Forkhead (Drosophila) like 10; Forkhead box I1; Forkhead box protein I1; Forkhead like 10; Forkhead related activator 6; Forkhead related transcription factor 6; Forkhead-related protein FKHL10; Forkhead-related transcription factor 6; FOXI1; FOXI1_HUMAN; FREAC 6; FREAC-6; FREAC6; Hepatocyte nuclear factor 3 forkhead homolog 3; HFH 3; HFH-3; HFH3; HNF 3/fork head homolog 3; HNF-3 fork-head homolog 3; HNF-3/fork-head homolog 3; Human HNF-3 fork-head homolog-3 HFH-3 mRNA complete cds; MGC34197
Target Background
This gene belongs to the forkhead family of transcription factors, which is characterized by a distinct forkhead domain. This gene may play an important role in the development of the cochlea and vestibulum, as well as in embryogenesis. The encoded protein has been found to be required for the transcription of four subunits of a proton pump found in the inner ear, the kidney, and the epididymis. Mutations in this gene have been associated with deafness, autosomal recessive 4.
Notification