-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FOXM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 29-128 of human FOXM1 (NP_068772.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ChIP, ELISA.
The antibody against FOXM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 29-128 of human FOXM1 (NP_068772.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ChIP, ELISA.
| Cat.No | ADA-12684A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FOXM1 |
| Target Synonyms | MPP2; HFH11; HNF-3; INS-1; MPP-2; PIG29; FKHL16; FOXM1A; FOXM1B; FOXM1C; HFH-11; TRIDENT; MPHOSPH2; FOXM1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HT-29 | Application | ELISA, WB, ChIP, IF/ICC, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 29-128 of human FOXM1 (NP_068772.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EEEPKRSPAQQESNQAEASKEVAESNSCKFPAGIKIINHPTMPNTQVVAIPNNANIHSIITALTAKGKESGSSGPNKFILISCGGAPTQPPGLRPQTQTS | Uniprot ID | Q08050 |
Uniprot Id
Q08050
Target Species
Human
Target Name
FOXM1
Target Full Name
Forkhead box protein M1
Target Function
Transcriptional factor regulating the expression of cell cycle genes essential for DNA replication and mitosis. Plays a role in the control of cell proliferation. Plays also a role in DNA breaks repair participating in the DNA damage checkpoint response.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Expressed in thymus, testis, small intestine, colon followed by ovary. Appears to be expressed only in adult organs containing proliferating/cycling cells or in response to growth factors. Also expressed in epithelial cell lines derived from tumors. Not e
Target Research Area
Others
Target Synonyms
FKHL16; Forkhead box M1; Forkhead box protein M1; forkhead like 16; Forkhead-related protein FKHL16; FOX M1; Foxm1; FOXM1_HUMAN; FOXM1B; Hepatocyte nuclear factor 3 forkhead homolog 11; HFH-11; HFH11; HNF-3/fork-head homolog 11; HNF3; INS1; M phase phosphoprotein 2; M-phase phosphoprotein 2; MPHOSPH2; MPM-2 reactive phosphoprotein 2; MPP2; PIG29; TGT3; Transcription factor Trident; Trident; WIN; Winged-helix factor from INS-1 cells; Winged-helix factor from INS1 cells
Target Background
The protein encoded by this gene is a transcriptional activator involved in cell proliferation. The encoded protein is phosphorylated in M phase and regulates the expression of several cell cycle genes, such as cyclin B1 and cyclin D1. Several transcript variants encoding different isoforms have been found for this gene.
Notification