-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FOXO3A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 574-673 of human FOXO3A (NP_001446.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FOXO3A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 574-673 of human FOXO3A (NP_001446.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16916A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FOXO3A |
| Target Synonyms | FOXO2; AF6q21; FKHRL1; FOXO3A; FKHRL1P2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse brain, Mouse lung, PC-3 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 574-673 of human FOXO3A (NP_001446.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SPVSQSMQTLSDSLSGSSLYSTSANLPVMGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFTGAKQASSQSWVPG | Uniprot ID | O43524 |
Uniprot Id
O43524
Target Species
Human
Target Name
FOXO3
Target Full Name
Forkhead box protein O3
Target Function
Transcriptional activator that recognizes and binds to the DNA sequence 5'-[AG]TAAA[TC]A-3' and regulates different processes, such as apoptosis and autophagy. Acts as a positive regulator of autophagy in skeletal muscle: in starved cells, enters the nucleus following dephosphorylation and binds the promoters of autophagy genes, such as GABARAP1L, MAP1LC3B and ATG12, thereby activating their expression, resulting in proteolysis of skeletal muscle proteins. Triggers apoptosis in the absence of survival factors, including neuronal cell death upon oxidative stress. Participates in post-transcriptional regulation of MYC: following phosphorylation by MAPKAPK5, promotes induction of miR-34b and miR-34c expression, 2 post-transcriptional regulators of MYC that bind to the 3'UTR of MYC transcript and prevent its translation. In response to metabolic stress, translocates into the mitochondria where it promotes mtDNA transcription. In response to metabolic stress, translocates into the mitochondria where it promotes mtDNA transcription. Also acts as a key regulator of chondrogenic commitment of skeletal progenitor cells in response to lipid availability: when lipids levels are low, translocates to the nucleus and promotes expression of SOX9, which induces chondrogenic commitment and suppresses fatty acid oxidation. Also acts as a key regulator of regulatory T-cells (Treg) differentiation by activating expression of FOXP3.
Target Involvement
A chromosomal aberration involving FOXO3 is found in secondary acute leukemias. Translocation t(6;11)(q21;q23) with KMT2A/MLL1.
Target Subcellular Location
Cytoplasm, cytosol. Nucleus. Mitochondrion matrix. Mitochondrion outer membrane; Peripheral membrane protein; Cytoplasmic side.
Target Tissue Specificity
Ubiquitous.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
AF6q21; AF6q21 protein; DKFZp781A0677; FKHR2; FKHRL 1; FKHRL1; FKHRL1P2; Forkhead (Drosophila) homolog (rhabdomyosarcoma) like 1; Forkhead box O3; Forkhead box O3A; Forkhead box protein O3; Forkhead box protein O3A; Forkhead Drosophila homolog of in rhabdomyosarcoma like 1; Forkhead homolog (rhabdomyosarcoma) like 1; Forkhead in rhabdomyosarcoma like 1; Forkhead in rhabdomyosarcoma-like 1; FOX O3A; FOXO2; foxo3; FOXO3_HUMAN; FOXO3A; MGC12739; MGC31925
Target Background
This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. This gene likely functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of this gene with the MLL gene is associated with secondary acute leukemia. Alternatively spliced transcript variants encoding the same protein have been observed.
Notification