-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FOXO4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 230-341 of human FOXO4 (NP_005929.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against FOXO4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 230-341 of human FOXO4 (NP_005929.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04140A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FOXO4 |
| Target Synonyms | AFX; AFX1; MLLT7; FOXO4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, RD, U-937 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 230-341 of human FOXO4 (NP_005929.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SPVGHFAKWSGSPCSRNREEADMWTTFRPRSSSNASSVSTRLSPLRPESEVLAEEIPASVSSYAGGVPPTLNEGLELLDGLNLTSSHSLLSRSGLSGFSLQHPGVTGPLHTY | Uniprot ID | P98177 |
Uniprot Id
P98177
Target Species
Human
Target Name
FOXO4
Target Full Name
Forkhead box protein O4
Target Function
Transcription factor involved in the regulation of the insulin signaling pathway. Binds to insulin-response elements (IREs) and can activate transcription of IGFBP1. Down-regulates expression of HIF1A and suppresses hypoxia-induced transcriptional activation of HIF1A-modulated genes. Also involved in negative regulation of the cell cycle. Involved in increased proteasome activity in embryonic stem cells (ESCs) by activating expression of PSMD11 in ESCs, leading to enhanced assembly of the 26S proteasome, followed by higher proteasome activity.
Target Involvement
A chromosomal aberration involving FOXO4 is found in acute leukemias. Translocation t(X;11)(q13;q23) with KMT2A/MLL1. The result is a rogue activator protein.
Target Subcellular Location
Cytoplasm. Nucleus. Note=When phosphorylated, translocated from nucleus to cytoplasm. Dephosphorylation triggers nuclear translocation. Monoubiquitination increases nuclear localization. When deubiquitinated, translocated from nucleus to cytoplasm.
Target Tissue Specificity
Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Isoform zeta is most abundant in the liver, kidney, and pancreas.
Target Synonyms
AFX; AFX1; Afxh; ALL1-fused gene from X chromosome; Fork head domain transcription factor AFX1; Forkhead box O4; Forkhead box protein O4; FOXO 4; Foxo4; FOXO4_HUMAN; MGC117660; MGC120490; Mixed lineage leukemia; translocated to; 7; MLLT7; Myeloid/lymphoid or mixed lineage leukemia (trithorax homolog; Drosophila); translocated to; 7; Myeloid/lymphoid or mixed lineage leukemia; translocated to; 7; RGD1561201
Target Background
This gene encodes a member of the O class of winged helix/forkhead transcription factor family. Proteins encoded by this class are regulated by factors involved in growth and differentiation indicating they play a role in these processes. A translocation involving this gene on chromosome X and the homolog of the Drosophila trithorax gene, encoding a DNA binding protein, located on chromosome 11 is associated with leukemia. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification