Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FOXRED1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 307-486 of human FOXRED1 (NP_060017.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FOXRED1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 307-486 of human FOXRED1 (NP_060017.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01457A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FOXRED1 |
| Target Synonyms | H17; FP634; MC1DN19; FOXRED1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, A-549, HepG2, K-562, Mouse lung, Rat kidney, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 307-486 of human FOXRED1 (NP_060017.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GPPGTLQGTKLPVEPRKRYVYVWHCPQGPGLETPLVADTSGAYFRREGLGSNYLGGRSPTEQEEPDPANLEVDHDFFQDKVWPHLALRVPAFETLKVQSAWAGYYDYNTFDQNGVVGPHPLVVNMYFATGFSGHGLQQAPGIGRAVAEMVLKGRFQTIDLSPFLFTRFYLGEKIQENNII | Uniprot ID | Q96CU9 |
Uniprot Id
Q96CU9
Target Species
Human
Target Name
FOXRED1
Target Full Name
FAD-dependent oxidoreductase domain-containing protein 1
Target Function
Required for the assembly of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). Involved in mid-late stages of complex I assembly.
Target Involvement
Mitochondrial complex I deficiency (MT-C1D)
Target Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.
Target Synonyms
FOXRED1; FP634; FAD-dependent oxidoreductase domain-containing protein 1
Target Background
This gene encodes a protein that contains a FAD-dependent oxidoreductase domain. The encoded protein is localized to the mitochondria and may function as a chaperone protein required for the function of mitochondrial complex I. Mutations in this gene are associated with mitochondrial complex I deficiency. Alternatively spliced transcript variants have been observed for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
