Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FPR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human FPR1 (NP_002020.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against FPR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human FPR1 (NP_002020.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
Immunohistochemistry analysis of paraffin-embedded human colon using FPR1 Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
| Cat.No | ADA-01106A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FPR1 |
| Target Synonyms | FPR; FMLP; FPR1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human FPR1 (NP_002020.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FFLCWSPYQVVALIATVRIRELLQGMYKEIGIAVDVTSALAFFNSCLNPMLYVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK | Uniprot ID | P21462 |
Uniprot Id
P21462
Target Species
Human
Target Name
FPR1
Target Full Name
fMet-Leu-Phe receptor
Target Function
High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors. Binding of fMLP to the receptor stimulates intracellular calcium mobilization and superoxide anion release. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Receptor for TAFA4, mediates its effects on chemoattracting macrophages, promoting phagocytosis and increasing ROS release.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Neutrophils.
Target Research Area
Immunology
Target Synonyms
FPR1; fMet-Leu-Phe receptor; fMLP receptor; N-formyl peptide receptor; FPR; N-formylpeptide chemoattractant receptor
Target Background
This gene encodes a G protein-coupled receptor of mammalian phagocytic cells that is a member of the G-protein coupled receptor 1 family. The protein mediates the response of phagocytic cells to invasion of the host by microorganisms and is important in host defense and inflammation.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
