-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FPS/FDPS was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 320-419 of human FPS/FDPS (P14324) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FPS/FDPS was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 320-419 of human FPS/FDPS (P14324) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13310A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FPS/FDPS |
| Target Synonyms | FPS; FPPS; POROK9; FPS/FDPS | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 22Rv1, HepG2, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 320-419 of human FPS/FDPS (P14324). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKEAEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK | Uniprot ID | P14324 |
Uniprot Id
P14324
Target Species
Human
Target Name
FDPS
Target Full Name
Farnesyl pyrophosphate synthase
Target Function
Key enzyme in isoprenoid biosynthesis which catalyzes the formation of farnesyl diphosphate (FPP), a precursor for several classes of essential metabolites including sterols, dolichols, carotenoids, and ubiquinones. FPP also serves as substrate for protein farnesylation and geranylgeranylation. Catalyzes the sequential condensation of isopentenyl pyrophosphate with the allylic pyrophosphates, dimethylallyl pyrophosphate, and then with the resultant geranylpyrophosphate to the ultimate product farnesyl pyrophosphate.
Target Involvement
Porokeratosis 9, multiple types (POROK9)
Target Subcellular Location
Cytoplasm.
Target Protein Families
FPP/GGPP synthase family
Target Research Area
Metabolism
Target Synonyms
(2E; (2E,6E) farnesyl diphosphate synthase; 6E)-farnesyl diphosphate synthase; Dimethylallyltranstransferase; Farnesyl diphosphate synthase; Farnesyl diphosphate synthetase; Farnesyl pyrophosphate synthase; Farnesyl pyrophosphate synthetase; Fdps; FPP synthase; FPP synthetase; FPPS; FPPS_HUMAN; FPS; Geranyltranstransferase
Target Background
This gene encodes an enzyme that catalyzes the production of geranyl pyrophosphate and farnesyl pyrophosphate from isopentenyl pyrophosphate and dimethylallyl pyrophosphate. The resulting product, farnesyl pyrophosphate, is a key intermediate in cholesterol and sterol biosynthesis, a substrate for protein farnesylation and geranylgeranylation, and a ligand or agonist for certain hormone receptors and growth receptors. Drugs that inhibit this enzyme prevent the post-translational modifications of small GTPases and have been used to treat diseases related to bone resorption. Multiple pseudogenes have been found on chromosomes 1, 7, 14, 15, 21 and X. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification