Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FRMD6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 82-183 of human FRMD6 (NP_001253975.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against FRMD6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 82-183 of human FRMD6 (NP_001253975.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-00825A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FRMD6 |
| Target Synonyms | EX1; Willin; C14orf31; c14_5320; FRMD6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, HepG2, MCF7, OVCAR8, Rat lung, Rat spleen, SH-SY5Y | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 82-183 of human FRMD6 (NP_001253975.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KEWKKEASKVRQYEVTWGIDQFGPPMIIHFRVQYYVENGRLISDRAARYYYYWHLRKQVLHSQCVLREEAYFLLAAFALQADLGNFKRNKHYGKYFEPEAYF | Uniprot ID | Q96NE9 |
Uniprot Id
Q96NE9
Target Species
Human
Target Name
FRMD6
Target Full Name
FERM domain-containing protein 6
Target Subcellular Location
Cytoplasm. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Note=Can colocalize with actin.
Target Synonyms
FRMD6; C14orf31FERM domain-containing protein 6; Willin
Target Background
Predicted to be involved in actomyosin structure organization. Predicted to act upstream of or within apical constriction; cellular protein localization; and regulation of actin filament-based process. Predicted to be located in apical junction complex. Predicted to be active in cytoskeleton.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
