Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FST was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human FST (P19883) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FST was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human FST (P19883) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04237A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FST |
| Target Synonyms | FS; FST | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, Rat pancreas | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human FST (P19883). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW | Uniprot ID | P19883 |
Uniprot Id
P19883
Target Species
Human
Target Name
FST
Target Full Name
Follistatin
Target Function
Binds directly to activin and functions as an activin antagonist. Specific inhibitor of the biosynthesis and secretion of pituitary follicle stimulating hormone (FSH).
Target Subcellular Location
Secreted.
Target Tissue Specificity
Isoform 1 is the predominant isoform in serum but is undetectable in follicular fluid. In the embryo, strong expression is seen in the palatal epithelia, including the medial edge epithelial and midline epithelial seam of the palatal shelves. Less pronoun
Target Synonyms
Activin binding protein ; Activin-binding protein; Follistatin; FS; fst; FST_HUMAN; Human follistatin gene
Target Background
Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
