Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FTCD was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 412-541 of human FTCD (NP_006648.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FTCD was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 412-541 of human FTCD (NP_006648.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00979A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FTCD |
| Target Synonyms | LCHC1; FTCD | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 412-541 of human FTCD (NP_006648.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DAEAFTAYLEAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE | Uniprot ID | O95954 |
Uniprot Id
O95954
Target Species
Human
Target Name
FTCD
Target Full Name
Formimidoyltransferase-cyclodeaminase
Target Function
Folate-dependent enzyme, that displays both transferase and deaminase activity. Serves to channel one-carbon units from formiminoglutamate to the folate pool.; Binds and promotes bundling of vimentin filaments originating from the Golgi.
Target Involvement
Glutamate formiminotransferase deficiency (FIGLU-URIA)
Target Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole. Golgi apparatus. Note=More abundantly located around the mother centriole.
Target Protein Families
Cyclodeaminase/cyclohydrolase family; Formiminotransferase family
Target Research Area
Others
Target Synonyms
Formimidoyltetrahydrofolate cyclodeaminase; Formimidoyltransferase cyclodeaminase; Formiminotetrahydrofolate cyclodeaminase; Formiminotransferase cyclodeaminase; Formiminotransferase-cyclodeaminase; FTCD; FTCD_HUMAN; Glutamate formiminotransferase; Glutamate formyltransferase; LCHC 1; LCHC1
Target Background
The protein encoded by this gene is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool. Mutations in this gene are associated with glutamate formiminotransferase deficiency. Alternatively spliced transcript variants have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
